General Information

  • ID:  hor003039
  • Uniprot ID:  Q8NG41
  • Protein name:  Neuropeptide B-23
  • Gene name:  NPB
  • Organism:  Homo sapiens (Human)
  • Family:  Neuropeptide B/W family
  • Source:  Human
  • Expression:  Widely expressed in the central nervous system. High levels are found in substantia nigra, hypothalamus, hippocampus, spinal cord, placenta and fetal brain; lower levels are found in testis, uterus and ovary. Also detected at high levels in colorectal ade
  • Disease:  Diseases associated with NPB include Niemann-Pick Disease, Type B and Gallbladder Papillomatosis.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005515 protein binding
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  WYKPAAGHSSYSVGRAAGLLSGLR
  • Length:  24(25-48)
  • Propeptide:  MARSATLAAAALALCLLLAPPGLAWYKPAAGHSSYSVGRAAGLLSGLRRSPYARRSQPYRGAEPPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANVFLSLRAADCLAA
  • Signal peptide:  MARSATLAAAALALCLLLAPPGLA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May be involved in the regulation of feeding, neuroendocrine system, memory, learning and in the afferent pain pathway
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPBWR1, NPBWR2
  • Target Unid:   P48145, P48146
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O23262-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-O23262-F1.pdbhor003039_AF2.pdbhor003039_ESM.pdb

Physical Information

Mass: 291526 Formula: C113H174N34O31
Absent amino acids: CDEFIMNQT Common amino acids: AGS
pI: 10.65 Basic residues: 4
Polar residues: 10 Hydrophobic residues: 9
Hydrophobicity: -13.33 Boman Index: -2180
Half-Life / Aliphatic Index: 2.8 hour Aliphatic Index: 77.5
Instability Index: 2697.92 Extinction Coefficient cystines: 8480
Absorbance 280nm: 368.7

Literature

  • PubMed ID:  12118011
  • Title:  Identification of a Neuropeptide Modified With Bromine as an Endogenous Ligand for GPR7